PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008238772.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family TCP
Protein Properties Length: 330aa    MW: 34125.9 Da    PI: 5.6232
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008238772.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP112.65.4e-3586157273
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                     ++++ +++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++t+ WLl+ a++ai+e+tgt++ +a ++
  XP_008238772.1  86 PTRRASTKDRHTKVEGRGRRIRMPATCAARIFQLTRELGHKSDGETVRWLLEHAEEAIIEATGTGTVPAIAV 157
                     57999***********************************************************99888444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.9E-2991156IPR005333Transcription factor, TCP
PROSITE profilePS5136926.99492146IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MTSYLEDQDD DGGTSDLSTS TGDPEDNNNN GNGVVSTQPN FDETTAFQQL KEEPIDSDPP  60
PQAHSIGMVP VAMQMPMSVA VPVSNPTRRA STKDRHTKVE GRGRRIRMPA TCAARIFQLT  120
RELGHKSDGE TVRWLLEHAE EAIIEATGTG TVPAIAVSVG GTSSGLAPVG PAAPQGLVPV  180
WAVGGAGLMV PANAFWMGPV GSGGGPSGPQ PQIWALSPTV TPVFNVAGAT RPVSSFVANN  240
GGGVEVRAPS PALSNSAVST STVGPRAAKR SSTTMAPSVS SSSNNSNGSG SGASKAQMLR  300
DFSLEIYDKQ ELQFMGRPVG SPTTHQHQTQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008238772.10.0PREDICTED: transcription factor TCP9-like
SwissprotO646472e-53TCP9_ARATH; Transcription factor TCP9
TrEMBLM5WG460.0M5WG46_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s08590.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.11e-40TCP family protein